DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:269 Identity:71/269 - (26%)
Similarity:116/269 - (43%) Gaps:67/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHC----------FRAPGRDL 328
            |..|.....||:|::|.:  ...|||..:.|||::|..:.||:||||          :.|...:.
  Fly    41 ITNGNLASEGQVPYIVGV--SLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNE 103

  Fly   329 PASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENF-QFKQFT--EADLALVRLDEPVRYTDYIVPI 390
            ||.|..||                      .||| ::..:.  :.||||::    ..:.|:    
  Fly   104 PAFRHTVS----------------------SENFIRYPHYVGLDHDLALIK----TPHVDF---- 138

  Fly   391 CLWSTSNRMDLP---QGLKSY------VAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVL 446
              :|..|:::||   ....||      .||||....|:...|..:|.||.::|.|.|........
  Fly   139 --YSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDT 201

  Fly   447 VQPSSLCAK-KTGAGPCASDGGGPLMLREQD--VWVLRGVISGGVINEKENTCELSKPSVFTDVA 508
            ...:::|.: ..|...|..|.||||:.:|.|  :.:...|.:.|        |::..|:.||.|.
  Fly   202 ASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYG--------CQVGGPAGFTRVT 258

  Fly   509 KHIEWVRQK 517
            |::||::::
  Fly   259 KYLEWIKEE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 70/264 (27%)
Tryp_SPc 277..514 CDD:214473 69/261 (26%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 70/264 (27%)
Tryp_SPc 41..266 CDD:238113 71/266 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.