DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG11843

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:266 Identity:69/266 - (25%)
Similarity:114/266 - (42%) Gaps:31/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 STTPLIFQGKSLQRGQLPWLVAIFERRESNGPA-FICGGTLISTSTVLSAAHCFRAPGRDLPASR 332
            |.||||..|...|..:.|.:..:..|.:.:..| :.|||.|||...||:||||..:...::...|
  Fly    63 SYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVR 127

  Fly   333 LAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSN 397
            |. .|..::|...:......|:..|.|..::..||.. |:.||:|.|.|.:..|..|.||.....
  Fly   128 LG-ELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYH-DIGLVKLTEAVVFDLYKHPACLPFQDE 190

  Fly   398 RMDLPQGLKSYVA-GWGPDETGTGNTEVSKVTDLNIVSEANCAL---------ELPHVLVQPSSL 452
            |..     .|::| |||  .||......:::..:.:....|...         |.|......:.|
  Fly   191 RSS-----DSFIAVGWG--STGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQL 248

  Fly   453 C-AKKTGAGPCASDGGGPLMLREQD---VWVLRGVISGGVINEKENTC-ELSKPSVFTDVAKHIE 512
            | ..:.....|..|.||||::..::   ::|:.|:.|.|:      :| ....|.::|.|..::.
  Fly   249 CVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGL------SCGSPGIPGIYTRVYPYLG 307

  Fly   513 WVRQKM 518
            |:.:.:
  Fly   308 WIARTL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 64/255 (25%)
Tryp_SPc 277..514 CDD:214473 63/252 (25%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 65/258 (25%)
Tryp_SPc 68..309 CDD:214473 64/255 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.