DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG4815

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:235 Identity:65/235 - (27%)
Similarity:101/235 - (42%) Gaps:47/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 NGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLI---IH 359
            ||...:|..||::...:|:|||||    .:|..|:..| :|..:......|.....::||   ||
  Fly    55 NGRKLVCSATLLTPRHILTAAHCF----ENLNRSKFHV-IGGKSAEFTWHGNNFNKNKLIRVQIH 114

  Fly   360 ENFQFKQFTEADLALVRLDEPVR--YTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNT 422
            ..:...:|. ||:|:.:...|:|  |..| ..:|      |..|....|...|||| .|.|..:.
  Fly   115 PKYAKMKFI-ADVAVAKTKYPLRSKYIGY-AQLC------RSVLHPRDKLIAAGWG-FEGGVWDE 170

  Fly   423 EVSKV---TDLNIVSEANCALELPHVLVQPSSLCA----KKTGAGPCASDGGGPLMLREQ----D 476
            ...|.   ..:.|||:.:|..:|...: .|:.:||    .||   .|..|.||||:|..|    :
  Fly   171 SRKKTFRSMKVGIVSKRDCEKQLDRKM-PPNIICAGAYNNKT---LCFGDSGGPLLLGRQVCGIN 231

  Fly   477 VWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVRQ 516
            .|..:   .|.  ||        ||.|:..|..:.:::::
  Fly   232 TWTFK---CGN--NE--------KPDVYMGVRYYAKFIKR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 65/235 (28%)
Tryp_SPc 277..514 CDD:214473 65/231 (28%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 65/235 (28%)
Trypsin 49..256 CDD:278516 65/231 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.