DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and SPE

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:319 Identity:98/319 - (30%)
Similarity:144/319 - (45%) Gaps:59/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 PNPSRSNAPQQAVRSPVDLVPQQNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAI-FERR 295
            |.||..:|.||.     |::|     .|.: ||...|..   ||.|.:....:.||:|.: :::.
  Fly   107 PTPSTRDALQQG-----DVLP-----GNDV-CGFLFADR---IFGGTNTTLWEFPWMVLLQYKKL 157

  Fly   296 ESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRL-AVSLG-----------------RNTL 342
            .|....|.|||.|:::..||:|.||..:...|...:.| :|.||                 |...
  Fly   158 FSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICA 222

  Fly   343 AIHSDGEFRGVSQLIIHENFQFKQFTEA-DLALVRLDEPVRYTDYIVPICLWS----TSNRMDLP 402
            ..|.|.|   |.:.||||.:......:. |:|||||...|.||||:.||||.:    .:|.:|  
  Fly   223 PKHIDIE---VEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVD-- 282

  Fly   403 QGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELP--HVLVQPSSLCA-KKTGAGPCAS 464
            .|:.  |||||..|....:....|:| :|:.:..:|..:..  .|.:..|.:|| .:.|...|..
  Fly   283 YGMD--VAGWGLTENMQPSAIKLKIT-VNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGG 344

  Fly   465 DGGGPLML----REQDVWVLRGVISGGVINEKENTCELSK-PSVFTDVAKHIEWVRQKM 518
            |.|||||:    ..:||:.:.||.|.|.     ..|.|.. |.|:|.....|:|::||:
  Fly   345 DSGGPLMVPISTGGRDVFYIAGVTSYGT-----KPCGLKGWPGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 82/271 (30%)
Tryp_SPc 277..514 CDD:214473 81/268 (30%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 84/274 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.