DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG31199

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:259 Identity:57/259 - (22%)
Similarity:104/259 - (40%) Gaps:55/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 WLVAI-----FERR-ESNGPAFICGGTLISTSTVLSAAHCF-RAPGRDLPASRLAVSLGRNTLAI 344
            |:..|     ||.: ..||    |.|.|:|..|||:.|||| :..|   .|...:|.||     :
  Fly    52 WVARIVYGKGFEGKIRDNG----CLGVLVSKRTVLAPAHCFVQYNG---VAEAFSVHLG-----V 104

  Fly   345 HSDGEFRGV------------------SQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPIC 391
            |:.....||                  :::.||.::..:....: ||::.|....:....::|||
  Fly   105 HNKSAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNS-LAVLTLQRDAKIYPNVMPIC 168

  Fly   392 LWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCA-- 454
            :...|...:........|||....|      :....|.:|.:|...|..::..::...:::|.  
  Fly   169 MPPPSLLNETLVAQTFVVAGLRVFE------DFRLKTWVNTLSRGFCQSKVKTLVTSSNTVCGYH 227

  Fly   455 KKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINE--KENTCELSKPSVFTDVAKHIEWVRQ 516
            |:    |.|...|.||:..::...|.:.....|::.:  .||...:|.   |..:..:::::||
  Fly   228 KQ----PVAYYLGAPLVGLQKKGHVTQNYYLVGIMIDWRWENNRIMSS---FLAIRNYMDFIRQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 57/259 (22%)
Tryp_SPc 277..514 CDD:214473 55/255 (22%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 50/227 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.