DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG31219

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:292 Identity:77/292 - (26%)
Similarity:129/292 - (44%) Gaps:52/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 PSSNGIP----CGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAF-ICGGTLISTSTVL 315
            |..|.:|    ||  ::.:|..:..|...:....||:..:.....:..... .|.|:||:...||
  Fly    69 PPGNRLPSTEICG--QSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVL 131

  Fly   316 SAAHCFRAPGRDLPASRLAVSLGRNTL----AIHSDGEFRG-----------VSQLIIHENFQ-- 363
            ::|||.....|||  |..:|.||.:.:    |.:.|...:.           :.::|:|..|.  
  Fly   132 TSAHCVNGIPRDL--SLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSI 194

  Fly   364 FKQFTEADLALVRLDEPVRYTDYIVPICL----WSTSNRMDLPQGLKSYVAGWGPDETGTGNTEV 424
            ..:..|.|:||:||..||||...|:|||:    :...::::        :||||....|    :.
  Fly   195 SNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFFAKSKLE--------IAGWGKTNEG----QF 247

  Fly   425 SKVTDLNIVSE---ANCALELPHV-LVQPSSLCA-KKTGAGPCASDGGGPLMLREQDVWV-LRGV 483
            |:|.....:.|   |.|||..|:: |.|...:|| ...|...|..|.|||||:...:..| |.|:
  Fly   248 SQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGI 312

  Fly   484 ISGGVINEKENTCELSKPSVFTDVAKHIEWVR 515
            .:.|    .:|..::..|.::|..:..:.|::
  Fly   313 TTYG----SKNCGQIGIPGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 71/267 (27%)
Tryp_SPc 277..514 CDD:214473 70/264 (27%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 70/268 (26%)
Tryp_SPc 90..342 CDD:238113 71/269 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.