DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG5246

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:249 Identity:71/249 - (28%)
Similarity:110/249 - (44%) Gaps:29/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLG 338
            :..|.....|..|:.|:|......:    :|||::|:...:|:||||...|.:.|......|...
  Fly    42 VIGGVDSPTGFAPYQVSIMNTFGEH----VCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYT 102

  Fly   339 RNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQ 403
            |.......||.       .||.:.. |.....|:||:...:|:.|.|...||.|   :::..||:
  Fly   103 RPGAEYLVDGS-------KIHCSHD-KPAYHNDIALIHTAKPIVYDDLTQPIKL---ASKGSLPK 156

  Fly   404 -GLKSYVAGWGPDET-GTGNTEVSKVTDLNIVSEANCALELPHV-LVQPSSLCA-KKTGAGPCAS 464
             |.|..:.|||..:| |..:|::.|: |||.:...||...:.:. .:....:|. .:.|.|.|..
  Fly   157 VGDKLTLTGWGSTKTWGRYSTQLQKI-DLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHG 220

  Fly   465 DGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVRQKM 518
            |.||||:...|   .|.||::.|      ..|.:..|.||..||.:.:|:.|.|
  Fly   221 DSGGPLVDANQ---TLVGVVNWG------EACAIGYPDVFGSVAYYHDWIEQMM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 69/243 (28%)
Tryp_SPc 277..514 CDD:214473 68/240 (28%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 68/243 (28%)
Tryp_SPc 42..263 CDD:238113 69/245 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436922
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.