DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG4053

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:256 Identity:55/256 - (21%)
Similarity:105/256 - (41%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLG 338
            |..|:..:.|..|:.|:|    ::.....||.|.:::...:|:|.||    ..|.....|.:.:|
  Fly    35 IVGGQEAEDGVAPYQVSI----QTIWKTHICSGVILNEQWILTAGHC----ALDFSIEDLRIIVG 91

  Fly   339 RNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTD--YIVPICLWSTSNRMDL 401
            .|...  ..|:.....:.::|..:........|:||:.::|.:.:.|  .||.:      :|...
  Fly    92 TNDRL--EPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVEL------SREQP 148

  Fly   402 PQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANC--------ALELPHVLVQPSSLCA-KKT 457
            |.|....:.|||..|:.....:..:..:|.|::...|        .:::.|:       |. .:.
  Fly   149 PAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHI-------CTFTRE 206

  Fly   458 GAGPCASDGGGPLMLREQDVW--VLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVRQ 516
            |.|.|:.|.|||||      |  .|.|:::.|      ..|.:..|.::.:...:.:|:|:
  Fly   207 GEGACSGDSGGPLM------WEGKLVGLVNWG------RACGVGMPDMYANTVYYQDWIRR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 54/253 (21%)
Tryp_SPc 277..514 CDD:214473 52/249 (21%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 53/252 (21%)
Tryp_SPc 35..256 CDD:238113 55/256 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.