DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG17475

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:277 Identity:70/277 - (25%)
Similarity:103/277 - (37%) Gaps:79/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 LQRGQLPWLVAI----FERRESNGP------------------AFICGGTLISTSTVLSAAHCFR 322
            |...||.|:...    |:.|..||.                  ..||||.:|....||:||||..
  Fly    30 LSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVY 94

  Fly   323 APGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYI 387
            .    ...:.|.|..|  |:..........|.:..||.|:....: ..|:||:||::.:::.:|.
  Fly    95 G----YNPTYLRVITG--TVEYEKPDAVYFVEEHWIHCNYNSPDY-HNDIALIRLNDTIKFNEYT 152

  Fly   388 VPICLWSTSNRMDLP-----QGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLV 447
            .|         .:||     .|.:..:.|||..|. .|:|.       :|:.:|    .|.||:.
  Fly   153 QP---------AELPTAPVANGTQLLLTGWGSTEL-WGDTP-------DILQKA----YLTHVVY 196

  Fly   448 Q-------------PSSLCAKKTGA-GPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCEL 498
            .             |..:|...||. |.|..|.||||...    .||.|:::.|.      .|.|
  Fly   197 STCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHN----GVLYGLVNWGY------PCAL 251

  Fly   499 SKPSVFTDVAKHIEWVR 515
            ..|....:|..::||:|
  Fly   252 GVPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 70/277 (25%)
Tryp_SPc 277..514 CDD:214473 68/274 (25%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 63/255 (25%)
Tryp_SPc 50..269 CDD:238113 64/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436924
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.