DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG31265

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:278 Identity:68/278 - (24%)
Similarity:121/278 - (43%) Gaps:59/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PCGRER------ASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHC 320
            ||..:|      |..:..|..|:..:.|..|:.|::.....|:.    |||.:::.:.:::|.||
  Fly    19 PCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHN----CGGAILNENWIITAGHC 79

  Fly   321 FRAPGRDLPASRLAVSLGRNTL----AIHSDGEFRGVSQLIIHENFQFKQ-FTEADLALVRLDEP 380
            ..   ..:|| .:.|..|.|..    ||:...|        ||::..:.| :...|:|||:|.|.
  Fly    80 VE---NFIPA-LVNVITGTNKWAEPGAIYYTAE--------IHKHCMYDQPYMHNDIALVKLTEN 132

  Fly   381 VRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDET-GTGNTEVSKVTDLNIVSEANC------ 438
            :.:.:...||.|.:...::    |.:..:.|||.|.. |:...::.|:| :.:|....|      
  Fly   133 ITFNELTQPIALPTRPVQL----GEEIVLTGWGSDVAYGSSMEDLHKLT-VGLVPLDECYETFNR 192

  Fly   439 --ALELPHVLVQPSSLCA-KKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSK 500
              ::.:.|:       |. .:.|.|.|..|.||||:...|    |.||::.|      ..|.:..
  Fly   193 TSSMGVGHI-------CTFSREGEGACHGDSGGPLVSNGQ----LVGVVNWG------RPCGVGL 240

  Fly   501 PSVFTDVAKHIEWVRQKM 518
            |.|..:|..:::|:|.|:
  Fly   241 PDVQANVYYYLDWIRSKL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 62/254 (24%)
Tryp_SPc 277..514 CDD:214473 60/251 (24%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 61/255 (24%)
Tryp_SPc 39..257 CDD:238113 62/255 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.