DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and modSP

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:471 Identity:103/471 - (21%)
Similarity:157/471 - (33%) Gaps:121/471 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RVDFPIPTIPPKITSMQLNGVQLCSGGVYP-----------KPRTGITLRITWTPSYI------S 145
            :|..|:.|..|    ::|.|..|..|...|           .|.|..|:|.:....|:      |
  Fly   208 KVTTPVVTETP----LELLGCPLPLGDERPILTGDGSRVLTGPITRGTVRFSCKQGYVLEGEESS 268

  Fly   146 VFGVNPQPVPTRPRPAWQDESPQIDYRETRPSQPRLEDSGELFGRSNESL-----------PAFQ 199
            ....|.....|.|:        .:.|..|         :||..|.|.::|           ..|.
  Fly   269 YCAKNKWSTSTIPK--------CVKYCST---------AGEFDGYSTKALCTHNGQQVECRKPFH 316

  Fly   200 NPGWGTAPQQANPNRGITSQPEIP----------SPVPQRPTPNPSRSNAPQQAVRSPVDLVPQQ 254
            .||                 .|:.          ||:|:.........|..:|  |...|     
  Fly   317 PPG-----------------TEVKFVCSTGFKTLSPLPEMRCMKGGYWNRGRQ--RCEQD----- 357

  Fly   255 NPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAH 319
                    ||:...........|.::....:||.|.::.........|.|||:|::...|::|||
  Fly   358 --------CGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAH 414

  Fly   320 CFRAPGRDLPASR-----LAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTE---ADLALVR 376
            |....|..||.|.     :|....||......:.:.|.|..:.|...  :|..||   .||||:.
  Fly   415 CVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPG--YKGRTENYYQDLALLT 477

  Fly   377 LDEPVRYTDYIVPICLW--STSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEAN-- 437
            ||||...:..|.|||:.  |.:.:..:...::...|||..:..       .::..:..||::|  
  Fly   478 LDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNIENK-------HELQFVPAVSKSNSV 535

  Fly   438 CALELPHVLVQPSSLCAKKTGAG-PCASDGGG----PLMLREQDVWVLRGVISGGVINEKENTCE 497
            |...|..  :|....|....|.. .|..|.||    .|.......|........|||:...|..:
  Fly   536 CRRNLRD--IQADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQ 598

  Fly   498 LSKP-SVFTDVAKHIE 512
            .:.. :|.|:: :|.|
  Fly   599 CAHSLTVMTNI-QHFE 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649 8/27 (30%)
Tryp_SPc 277..517 CDD:238113 65/254 (26%)
Tryp_SPc 277..514 CDD:214473 65/254 (26%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056 7/40 (18%)
Sushi 309..354 CDD:278512 9/63 (14%)
Tryp_SPc 371..616 CDD:214473 65/255 (25%)
Tryp_SPc 371..591 CDD:304450 59/230 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.