DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG3505

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:294 Identity:81/294 - (27%)
Similarity:130/294 - (44%) Gaps:49/294 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 PSSNGI----------PCGR---ERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGT 307
            ||:.|:          .||:   :|::.|....:       :.|||..|...|.:......|||.
  Fly    83 PSTAGLGALTHPLLPSDCGKVRWQRSNDTDTRIR-------EFPWLALIEYTRGNQEKIHACGGV 140

  Fly   308 LISTSTVLSAAHCF-RAPGRDLPASRLAVSLGRNTLAIHSDGEFR---------------GVSQL 356
            |||...||:||||. :|...:|..:  ||.||....:.:.|.::.               .:.:|
  Fly   141 LISDRYVLTAAHCVAQAATSNLQIT--AVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEEL 203

  Fly   357 IIHENFQFKQFTEA-DLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTG 420
            :.|..:.....|:. |:|||||..|.:..|::.||||.:...|.|..:.|.:.||||  ..:.:.
  Fly   204 LPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGW--QASSSQ 266

  Fly   421 NTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAKKTGAGPCASDGGGPLMLREQDVWVLRGVIS 485
            ......|| ::.:.|.........:.:|.|.||. .|.:..|..:.||||||.:.|.::|.|::|
  Fly   267 RMRKGYVT-ISSIEECQRKYASQQLRIQASKLCG-LTNSQECYGNAGGPLMLFKNDGYLLGGLVS 329

  Fly   486 GGVINEKENTC-ELSKPSVFTDVAKHIEWVRQKM 518
            .|.:     .| ....|.|:|.||.:|:|:...:
  Fly   330 FGPV-----PCPNPDWPDVYTRVASYIDWIHDSL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 74/257 (29%)
Tryp_SPc 277..514 CDD:214473 73/254 (29%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 75/262 (29%)
Tryp_SPc 111..354 CDD:214473 74/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.