DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Sems

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:228 Identity:72/228 - (31%)
Similarity:106/228 - (46%) Gaps:36/228 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 WLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFR 351
            :|||:   |..|.  ||||||||....||:|||||     :..|.:.|.|:......:...|..|
  Fly    58 YLVAM---RYFNN--FICGGTLIHELIVLTAAHCF-----EDRAEKEAWSVDGGISRLSEKGIRR 112

  Fly   352 GVSQLIIHENFQFKQFT-EADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWG-- 413
            .|.:.|  ::.|||..| ..|:|:|.|:.|: ....|..:.|.||:    |..|....|:|||  
  Fly   113 QVKRFI--KSAQFKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTA----LTPGQTMDVSGWGMT 170

  Fly   414 -PDETGTGNTEVSKVTDLNIVSEANC-ALELPHVLVQPSSLCAKKTG-AGPCASDGGGPLMLREQ 475
             ||:.|.|:  :.:...:.::.:..| ......|.:..|..||...| ...|..|.||||:..:|
  Fly   171 NPDDEGPGH--MLRTVSVPVIEKRICREAYRESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQ 233

  Fly   476 DVWVLRGVISGGVINEKENTCELSK-PSVFTDV 507
                :.|::|.|:      .|...: |.|:|||
  Fly   234 ----VCGIVSFGI------GCASRRYPGVYTDV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 72/228 (32%)
Tryp_SPc 277..514 CDD:214473 72/228 (32%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 72/228 (32%)
Tryp_SPc 44..265 CDD:238113 72/228 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.