DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG14088

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:272 Identity:56/272 - (20%)
Similarity:99/272 - (36%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CGRERASTTPLIFQGKSLQRGQLPWLVAI--FERRESNGPAFICG-GTLISTSTVLSAAHCFRAP 324
            ||..|...:|.|..         ||...:  |.|        |.| ||||....:|:..||    
  Fly    31 CGERRDGLSPDIVG---------PWTAILHHFGR--------IVGVGTLIHERFILTDVHC---- 74

  Fly   325 GRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHE--------NFQFKQFTEA-DLALVRLDEP 380
            |..:...|..:            ||:..:...:..:        |..|...|:| ::.|::|...
  Fly    75 GDSIGVIRARL------------GEYGRIGSELAEDHIVAAFFSNANFNPETQANNMGLMKLLRT 127

  Fly   381 VRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHV 445
            |.|.::|:|:|:...|.       ::::.     ||....|....|.:|.:.:..:...:.:|..
  Fly   128 VVYKEHIIPVCILMDSR-------MQTFA-----DELDYFNGTTWKNSDKSPMLRSKTVIRMPQA 180

  Fly   446 L--VQPSSLCAKKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVA 508
            .  :.....||.......| .:..|..:.||.|.......:..|:.|..|..|..|:  .:|||.
  Fly   181 CGKLDHGQFCAGHKDLDSC-DEPSGAALTREIDYIGPNRTVLFGIANSVEVKCSNSR--TYTDVV 242

  Fly   509 KHIEWVRQKMWN 520
            :..:|:...:::
  Fly   243 QLHQWISMVIYS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 51/253 (20%)
Tryp_SPc 277..514 CDD:214473 50/250 (20%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 52/256 (20%)
Tryp_SPc 42..248 CDD:214473 51/253 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.