DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG8329

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:253 Identity:65/253 - (25%)
Similarity:113/253 - (44%) Gaps:41/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 LIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSL 337
            :|..|.....|:.|:.|.:   |.:||.  :.||::|..:.||:||||                |
  Fly    34 IIVNGYPAYEGKAPYAVGL---RMNNGA--VGGGSVIGNNWVLTAAHC----------------L 77

  Fly   338 GRNTLAIH--SDGEFRGVSQLIIHEN--FQFKQFTEA---DLALVRLDEPVRYTDYIVPICLWST 395
            ..:::.||  |:..:.|..|..:::|  |:...:..:   |:.|:|... |.:|:.|..:.|...
  Fly    78 TTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIGLIRTPY-VSFTNLINKVSLPKF 141

  Fly   396 SNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAKKT-GA 459
            |.:.:..:.......|||....| |..:..:..|:.::|...||..  :..|..:.:|.:.| |.
  Fly   142 SQKGERFENWWCVACGWGGMANG-GLADWLQCMDVQVISNGECARS--YGSVASTDMCTRATDGK 203

  Fly   460 GPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVRQK 517
            ..|..|.||.|:..:..:.|       |||......|: |.||.:|.|:.|::|:|:|
  Fly   204 SVCGGDSGGALVTHDNPIQV-------GVITFASIGCK-SGPSGYTRVSDHLDWIREK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 63/247 (26%)
Tryp_SPc 277..514 CDD:214473 61/244 (25%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 64/250 (26%)
Tryp_SPc 35..250 CDD:214473 62/247 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.