DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG3088

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:254 Identity:66/254 - (25%)
Similarity:103/254 - (40%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 LIFQGKSLQRGQLPWLVAIFERRESNGPAF-----ICGGTLISTSTVLSAAHCFRAPGRDLPASR 332
            :|..|.....||.|::|         |.||     .|.||:|..:.:|::|.|...      :|.
  Fly    28 IITNGSPAYEGQAPYVV---------GMAFGQSNIWCSGTIIGDTWILTSAQCLTG------SSG 77

  Fly   333 LAVSLGRNTLAIHSDGEFR---GVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWS 394
            :.:..|...|   |..:|.   |.|:.:....         .|||||:.. |.:::.:..:.|.|
  Fly    78 VTIYFGATRL---SQAQFTVTVGTSEYVTGNQ---------HLALVRVPR-VGFSNRVNRVALPS 129

  Fly   395 TSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAK-KTG 458
            ..||....:...:.|.|||......|.|:..:..||.|:|...|........|....||.: .:|
  Fly   130 LRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSG 194

  Fly   459 AGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVRQK 517
            ...|..|.|.|| :.:||..|:.  ||..|.:   |.|.|..|:.|..:...::|:.|:
  Fly   195 RSTCFGDAGSPL-ITKQDSTVVG--ISAFVAS---NGCTLGLPAGFARITSALDWIHQR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 64/248 (26%)
Tryp_SPc 277..514 CDD:214473 63/245 (26%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 65/250 (26%)
Tryp_SPc 29..244 CDD:214473 64/248 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.