DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:298 Identity:73/298 - (24%)
Similarity:114/298 - (38%) Gaps:76/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 SRSNAPQQAVR--SPVDLVPQQNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAI-FERRE 296
            |.:..|:.|..  :||.....|...:||.|.                 :.|:.|:.|.: |    
  Fly    16 SGATMPRLATEKLTPVHTKDMQGRITNGYPA-----------------EEGKAPYTVGLGF---- 59

  Fly   297 SNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLG----RNTLAIHSDGEFRGVSQLI 357
            |.|  :.|||::|:...||:|.||..      .|..:.|..|    .|....|..|         
  Fly    60 SGG--WWCGGSIIAHDWVLTAEHCIG------DADSVTVYFGATWRTNAQFTHWVG--------- 107

  Fly   358 IHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSY---------VAGWG 413
               |..|.:.:.||:||:|    :.:.|:      |...|:::||.....|         ..|||
  Fly   108 ---NGNFIKHSSADIALIR----IPHVDF------WHMVNKVELPSYNDRYNDYNEWWAVACGWG 159

  Fly   414 PDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAK-KTGAGPCASDGGGPLMLREQDV 477
            ....|:...:..:..||.|:..:.|:..  :..|..:.||.: ..|...|..|.||||:  ..|.
  Fly   160 GTYDGSPLPDYLQCVDLQIIHNSECSGY--YGSVGDNILCVRTPDGKSTCGGDSGGPLV--THDG 220

  Fly   478 WVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVR 515
            ..|.||.:.|.:    ..|:...|:.|..|..|::|:|
  Fly   221 TKLVGVTNFGSV----AGCQSGAPAGFQRVTYHLDWIR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 64/254 (25%)
Tryp_SPc 277..514 CDD:214473 62/251 (25%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 65/272 (24%)
Tryp_SPc 40..256 CDD:238113 67/274 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.