DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and sphinx2

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:257 Identity:57/257 - (22%)
Similarity:93/257 - (36%) Gaps:35/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 ERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPA 330
            |:...:|.|..|...:...:.:||.|...:..........||:||...:|:....       |..
  Fly    18 EKNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVKEV-------LIF 75

  Fly   331 SRLAVSLGRNTLAIHSDGEFRGVSQL-IIHENFQFKQFTEADLALV-----RLDEPVRYTDYIVP 389
            ..:....|       |...|.|...| |..|||.|.......:|||     :.|.  |.:...||
  Fly    76 KYIEAHFG-------SKRAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQKFDR--RMSRVRVP 131

  Fly   390 ICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCA 454
                :...|.:...|..:.|.|||.|:.........:..::.:::...||..  |..::...:|.
  Fly   132 ----AYGARFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTECAKY--HTPLKWYEMCT 190

  Fly   455 KKTG-AGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVR 515
            ...| .|.|..|.||.::....:...:      |:|......|.:..|||...|:.||:|::
  Fly   191 SGEGFKGVCEGDMGGAVVTMGPNPTFI------GIIWLMPTNCSIGYPSVHIRVSDHIKWIK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 54/246 (22%)
Tryp_SPc 277..514 CDD:214473 53/243 (22%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 54/247 (22%)
Tryp_SPc 26..248 CDD:304450 55/249 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.