DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG10469

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:265 Identity:74/265 - (27%)
Similarity:123/265 - (46%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 GRERASTTPLIFQGKSLQRGQLPW---LVAIFE--RRESNGPAFICGGTLISTSTVLSAAHCFRA 323
            |:|..|..  |..|.:.:..|||:   |:..||  :.|.|    :||||::|...:::||||.:.
  Fly    16 GQETGSLR--IMNGTAAKAKQLPYQVGLLCYFEGSKDEPN----MCGGTILSNRWIITAAHCLQD 74

  Fly   324 PGRDLPASRLAVSLGRNTLAIHSDGEF-RGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYI 387
            |..:|  .::.:.:|:  :....|.|. ...|..|:|:.|..|..|. |:||::|.:.:.:..||
  Fly    75 PKSNL--WKVLIHVGK--VKSFDDKEIVVNRSYTIVHKKFDRKTVTN-DIALIKLPKKLTFNKYI 134

  Fly   388 VPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVL------ 446
            .|..|.|.....   .|.|:.::|||. .|....::|.:.....|:|...|..:....|      
  Fly   135 QPAKLPSAKKTY---TGRKAIISGWGL-TTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKK 195

  Fly   447 -VQPSSLCAKKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKH 510
             |....:|.......||..|.|||::| :.....|.|::|.|...|    |:|..|.|.|.|:.:
  Fly   196 VVHNGFICIDSKKGLPCRGDSGGPMVL-DDGSRTLVGIVSHGFDGE----CKLKLPDVSTRVSSY 255

  Fly   511 IEWVR 515
            ::|::
  Fly   256 LKWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 70/252 (28%)
Tryp_SPc 277..514 CDD:214473 69/249 (28%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/255 (27%)
Tryp_SPc 24..260 CDD:238113 71/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.