DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG10472

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:272 Identity:77/272 - (28%)
Similarity:128/272 - (47%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 PSSNG--IPCGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAA 318
            |..:|  :|.||        |..|:..:..|.|:.|.:.  ....|.|..||||:||...:::||
  Fly    35 PKVHGETLPSGR--------ITGGQIAEPNQFPYQVGLL--LYITGGAAWCGGTIISDRWIITAA 89

  Fly   319 HCFRAPGRDLPASRLAVSLG-RNTLAIHSDGE---FRGVSQLIIHENFQFKQFTEADLALVRLDE 379
            ||     .|...:.:.|.|| .:......:|:   |.....:|:||::..:..|. |::|::|..
  Fly    90 HC-----TDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITN-DISLIKLPV 148

  Fly   380 PVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGP-DETGTGNTEVSKVTDLNIVSEANCALELP 443
            |:.:..||.|..|...|:......|..:..:|||. .::.||.|::.:...:.|::.:.|:   |
  Fly   149 PIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCS---P 210

  Fly   444 HV--LVQPSSLCAKKTGA-GPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFT 505
            ..  ||..|::|.|.||. ..|..|.||||:| :.....|.|..|.|:    ...||:..|.|||
  Fly   211 WYFGLVAASNICIKTTGGISTCNGDSGGPLVL-DDGSNTLIGATSFGI----ALGCEVGWPGVFT 270

  Fly   506 DVAKHIEWVRQK 517
            .:..:::|:.:|
  Fly   271 RITYYLDWIEEK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 70/247 (28%)
Tryp_SPc 277..514 CDD:214473 69/244 (28%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 71/256 (28%)
Tryp_SPc 47..282 CDD:238113 71/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.