DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:289 Identity:69/289 - (23%)
Similarity:115/289 - (39%) Gaps:94/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 IPCGRERASTTPLIFQGKSLQRGQLPWLVAI-FERRESNGPAFICGGTLISTSTVLSAAHCFRAP 324
            :|.|  :||....|..|.....|::|::|.: |.:   ||....|||::|..:.|::|.||    
  Fly    27 VPVG--KASIEGRITMGYPAYEGKVPYIVGLGFSK---NGGGTWCGGSIIGNTWVMTAKHC---- 82

  Fly   325 GRDLPASRLAVSLGRNTLAIHSDGEFR---------GVSQLIIHENFQFKQFTEADLALVRLDEP 380
                       :.|..::.|:....:|         |.|..|.|.:        .|::|:|    
  Fly    83 -----------TDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHGS--------GDISLIR---- 124

  Fly   381 VRYTDYIVPICLWSTSNRMDLP---------QGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSE- 435
            ..:.|:      ||..|:::||         ||..:.|:|||            |.:|...||| 
  Fly   125 TPHVDF------WSLVNKVELPRYDDRYNNYQGWWALVSGWG------------KTSDEGGVSEY 171

  Fly   436 ANCALELPHVLVQPSSLCAKKTGA--------------GPCASDGGGPLMLREQDVWVLRGVISG 486
            .||.    .|.:..:|:|....|:              |.|:.|.||||::.:.:..|  |::|.
  Fly   172 LNCV----DVQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQV--GIVSF 230

  Fly   487 GVINEKENTCELSKPSVFTDVAKHIEWVR 515
            |    ....|..:.|.....|..:::|:|
  Fly   231 G----SSAGCLSNGPKGMVRVTSYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 64/273 (23%)
Tryp_SPc 277..514 CDD:214473 62/270 (23%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 63/274 (23%)
Tryp_SPc 41..257 CDD:238113 64/273 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.