DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:288 Identity:73/288 - (25%)
Similarity:120/288 - (41%) Gaps:67/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 AVRSPVDLVPQQNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAI-FERRESNGPAFICGG 306
            |:..||.:  :..|:.|.|. ||        |..|.....|::|::||: |:  ..||..:.|||
  Fly    17 ALERPVPV--KDMPAGNKIN-GR--------ITNGYPAYEGKVPYIVALRFD--NGNGGGWYCGG 68

  Fly   307 TLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEA- 370
            ::|....||:||||      ...||.:.:|.|                 .:..:..||..:... 
  Fly    69 SIIGHEWVLTAAHC------TYGASYVTISYG-----------------AVWRQQPQFTHYDTGN 110

  Fly   371 ---DLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQ---------GLKSYVAGWGPDETGTGNTE 423
               |:||:|    ..:.|:      ||..|:::||:         |..:.::|||.....:|.|:
  Fly   111 LHNDIALIR----TPHVDF------WSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTD 165

  Fly   424 VSKVTDLNIVSEANCALELPHVLVQPSSLC-AKKTGAGPCASDGGGPLMLREQDVWVLRGVISGG 487
            .....|:.|...:.|........:..:.|| |.....|.|:.|.||||:|.:.:..|  |::|.|
  Fly   166 YLNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQV--GIVSFG 228

  Fly   488 VINEKENTCELSKPSVFTDVAKHIEWVR 515
                ....|..:.|...|.|..:::|:|
  Fly   229 ----SAAGCLSNSPKGLTRVTGYLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 64/254 (25%)
Tryp_SPc 277..514 CDD:214473 62/251 (25%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 64/263 (24%)
Tryp_SPc 37..254 CDD:238113 65/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.