DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:299 Identity:74/299 - (24%)
Similarity:119/299 - (39%) Gaps:74/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PQQAVRSPVDLVPQQNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFIC 304
            |||....|.||     |:...|. ||        |..||:...||.|:.|.:  ...|...::.|
  Fly    20 PQQVPIHPRDL-----PAVTNIE-GR--------ITNGKTATSGQFPYQVGL--SFASTSGSWWC 68

  Fly   305 GGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQL---IIHENF-QFK 365
            ||::|..:.||:||||               :.|.:.:.|:.....|..:||   :..:|| |..
  Fly    69 GGSIIDNTWVLTAAHC---------------TSGASAVTIYYGATVRTSAQLVQTVSADNFVQHA 118

  Fly   366 QFTEA----DLALVRLDEPVRYTDYIVPICLWSTSNRMDLP---------QGLKSYVAGWGPDET 417
            .:...    |::|:: ...|.:|..|         |:::||         .|.::..:|||  :|
  Fly   119 SYNSIVLRNDISLIK-TPTVAFTALI---------NKVELPAIAGTYSTYTGQQAIASGWG--KT 171

  Fly   418 GTGNTEVSKVTD---LNIVSEANCALELPHVLVQPSSLC-AKKTGAGPCASDGGGPLMLREQD-- 476
            ....|.|:....   ..:||.:.|......::...:.:| |.......|..|.||||:|....  
  Fly   172 SDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDSKL 236

  Fly   477 VWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVR 515
            :.|...|.|.|        ||...|:.||.|..:::|::
  Fly   237 IGVTSFVSSAG--------CESGAPAGFTRVTSYLDWIK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 63/262 (24%)
Tryp_SPc 277..514 CDD:214473 62/259 (24%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 64/271 (24%)
Tryp_SPc 40..269 CDD:238113 64/265 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471169
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.