DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:263 Identity:69/263 - (26%)
Similarity:113/263 - (42%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 RERASTTPL-------IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFR 322
            |.|:...|:       |..|.:...||.|:.|.:..:..:...|: |||:||.::.||:||||..
  Fly    22 RHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAW-CGGSLIGSTWVLTAAHCTD 85

  Fly   323 APGRDLPASRLAVSLGRNTLAIHSDGEFR---GVSQLIIHENFQFKQFTEADLALVRLDEPVRYT 384
            .      ...:.|.||   ..:.:..|..   ..|.:|||..:....... |::|::: .....:
  Fly    86 G------VQSVTVYLG---ATVRTSAEITHTVSSSDIIIHSGWNSANLRN-DISLIKI-PATSSS 139

  Fly   385 DYIVPICLWSTSNRMDLPQGLKSYVAGWG-PDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQ 448
            ..|..:.|.|.||......|..:..:||| ..:|.:|.....:..||.:::...||......:|.
  Fly   140 SRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVT 204

  Fly   449 PSSLCAKKTGA-GPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIE 512
            .|:||...|.| ..|..|.||||:|:.....:  |:.|.|.    ...||...|:.||.|..:::
  Fly   205 DSTLCVATTDAKSTCNGDSGGPLVLKSSSEQI--GLTSFGA----SAGCEKGYPAAFTRVTSYLD 263

  Fly   513 WVR 515
            |::
  Fly   264 WIK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 65/244 (27%)
Tryp_SPc 277..514 CDD:214473 64/241 (27%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 65/245 (27%)
Tryp_SPc 38..268 CDD:238113 66/247 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.