DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and try-9

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:256 Identity:60/256 - (23%)
Similarity:105/256 - (41%) Gaps:63/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 GTLISTSTVLSAAHCF---RAPGRDLPASRLA-----------VSLGRNTLAI-------HSDGE 349
            |||:|...:::|||..   ..|..|.....|.           |:....|.|:       |....
 Worm    30 GTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDM 94

  Fly   350 FR--GVSQLIIHENF------QFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQ--- 403
            |:  .:..|.|.:.:      ..:.|.  |:|:..|:||:.::..|.|.||.|...   :|:   
 Worm    95 FKPLAIKSLYIRKGYVGDGCIDRESFN--DIAVFELEEPIEFSKDIFPACLPSAPK---IPRIRE 154

  Fly   404 -GLKSYVAGWGPDETGTGNTEVSKVTDL-NIVSEANCALELPHVLVQPSSLCAKKTGAG-PCASD 465
             |.|.:  |:|.|.:.: ..|..|:..| :.|:|  |:.:.|:..|    .|......| .|..|
 Worm   155 TGYKLF--GYGRDPSDS-VLESGKLKSLYSFVAE--CSDDFPYGGV----YCTSAVNRGLSCDGD 210

  Fly   466 GGGPLMLREQD---VWVLRGVISGGV---------INEKENTCELSKPS-VFTDVAKHIEW 513
            .|.. ::|..|   |.||.||:|.|:         ..:::...:|::.: :..||:.|:::
 Worm   211 SGSG-VVRTSDTRNVQVLVGVLSAGMPCPELYDTHNRQRQQRRQLTQETDLLVDVSAHVDF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 60/256 (23%)
Tryp_SPc 277..514 CDD:214473 60/256 (23%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 56/221 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.