DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG17572

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:365 Identity:90/365 - (24%)
Similarity:140/365 - (38%) Gaps:102/365 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 QRPTPNPSRSNAPQQAVRSPVDLVPQQNPSSNGIPCGRERA---STTPLIFQ------------- 276
            ||.....:.:.....|.||..|:|  ||....|...|.|..   ..|.||::             
  Fly    38 QRSGARSNETTGHSVAARSYYDVV--QNAGQTGCSVGTECTPLHDCTALIYEVARSCYYGDKSLY 100

  Fly   277 ------------------------GKSLQRGQL-------PWLVAI-FERRESNGPAFICGGTLI 309
                                    ||||.:|..       |::..| |:...:...|:.|.|.:|
  Fly   101 CGGSSEELPYVCCPSSPLEKNQVCGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVI 165

  Fly   310 STSTVLSAAHC--FRAPGRDLPASRLAVSLGRNTLAIHSDGEF--------------------RG 352
            :...:|:||||  .:|.|..|.:.|:              ||:                    ..
  Fly   166 ARRVILTAAHCALAKADGHRLSSVRV--------------GEYDTSSDPDCANTGFCAPRSVNHA 216

  Fly   353 VSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDET 417
            :|.:|:|.:::..|: ..|:||:.|..|:.|:....||||..|  |.:|..|.::.:||||...|
  Fly   217 ISHVIVHPDYKQGQY-HHDIALLVLKTPLNYSVATQPICLQKT--RANLVVGKRATIAGWGKMST 278

  Fly   418 GTGNTEVSKVTDLNIVSEANC--------ALELPHVLVQPSSLCAKKTGAGPCASDGGGPLMLRE 474
            .:.........|:.:.|...|        |||.|: .::...:||...|...|...||.||.::|
  Fly   279 SSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPN-SIEGQWMCAGGEGKDVCQGFGGAPLFIQE 342

  Fly   475 QDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWV 514
            ..::...|::|.|    .:|...|..|||:|.||...||:
  Fly   343 NGIFSQIGIMSFG----SDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 75/276 (27%)
Tryp_SPc 277..514 CDD:214473 74/274 (27%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 70/263 (27%)
Tryp_SPc 138..378 CDD:214473 69/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.