DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG4650

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:292 Identity:77/292 - (26%)
Similarity:120/292 - (41%) Gaps:77/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRD 327
            ||        |:..||.......||:..:    .::...::||||:|:...||:||||.||    
  Fly    28 CG--------LLTNGKIANNISSPWMAYL----HTSELLYVCGGTVITEKLVLTAAHCTRA---- 76

  Fly   328 LPASRLAVSLGRNTLAIHSDGEFRG-------------VSQLIIHENFQFKQFTEA-DLALVRLD 378
              :.:|...:          |||.|             |||..||.  .:...|.| |:|::.|.
  Fly    77 --SEQLVARI----------GEFIGTDDANDTMLSEYQVSQTFIHS--LYNTTTSANDIAILGLA 127

  Fly   379 EPVRYTDYIVPICL-WSTSNR--MDLPQGLKSYVAGWG-PDETGTGNTEVSKVTDLNIVSEANCA 439
            ..:.::..|.|||: |.|..|  :|..|.|..  |.|| |::  ...::..::||:. ...||..
  Fly   128 TDIVFSKTIRPICIVWWTIWRKYIDNIQVLSG--AQWGLPND--RNESDAFRITDIR-RQPANMC 187

  Fly   440 LELPHVLVQPSSLCAKKTGAGPCASDGGGPL----MLREQDVWVLRGVISGGVINEKENTCELSK 500
            ..|....:..|..||..:.:..|..|...||    ..:....:||.|:   ...|:|   |:  :
  Fly   188 STLNGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGI---ATTNQK---CK--R 244

  Fly   501 PSVFTDVAKHIEWV----RQ--------KMWN 520
            .||:|||..|.:::    ||        |.|:
  Fly   245 ASVYTDVLSHTDFILSVWRQYRNGEKSPKTWD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 72/273 (26%)
Tryp_SPc 277..514 CDD:214473 70/258 (27%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 70/259 (27%)
Tryp_SPc 33..258 CDD:304450 70/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.