DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG9377

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:316 Identity:71/316 - (22%)
Similarity:121/316 - (38%) Gaps:75/316 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 NAPQQAVRSPVDLVPQQNPSSNGIPCGRER---ASTTPLIFQGKSLQRGQLPWLVAIFERRESNG 299
            |.|.   :.|...:|::..|   .|||...   ....||.::.:..:.|:.|||||::     ..
  Fly    68 NIPD---KLPTPKIPEEMMS---CPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVY-----GS 121

  Fly   300 PAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSD---GEFRGVSQLIIHEN 361
            ..::|.|.||:...|::.|||.:  ..::...||..  |....|:..:   .:.|.|.:.::|.|
  Fly   122 DTYLCSGALITPLAVITTAHCVQ--NSEMEKVRLLA--GEWDAAVELEPQPHQQRSVVETLVHPN 182

  Fly   362 FQFKQFTEADLA------LVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTG 420
                 :|:..||      ||..::|.:....:.||||.......:..|   .||:||...:.|..
  Fly   183 -----YTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQ---CYVSGWQRSDFGRA 239

  Fly   421 NTEVSKVTDLNIVSEANCALELPHVLV------QPSSLCAKKTGAGPCASDGGG----------- 468
             ..:.|...|.::....|..:|...|:      ..|.|||        ..|.|.           
  Fly   240 -AILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCA--------GGDKGDFVCGDVDMTAV 295

  Fly   469 PLML---REQDVWVLRGVISGGVINEKENTCELSKP---SVFTDVAKHIEWVRQKM 518
            |||.   ...|.:.|.|:::        .|.....|   .::|:|..:.:|:..|:
  Fly   296 PLMCPLSGHDDRFHLAGLLT--------RTARCDGPQLLGIYTNVKLYRQWIDLKL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 60/271 (22%)
Tryp_SPc 277..514 CDD:214473 59/268 (22%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 60/268 (22%)
Tryp_SPc 105..339 CDD:214473 59/267 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.