DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and sphe

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:223 Identity:61/223 - (27%)
Similarity:106/223 - (47%) Gaps:27/223 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 AFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFK 365
            |.:|||:::|.:.:|:.|||....|:.:.|||||..:|....  ::.|:...|..:.:|.::   
  Fly    48 AHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQ--YAGGKIVNVESVAVHPDY--- 107

  Fly   366 QFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLP-QGLKSYVAGWGPDETGTGNTEVSKVTD 429
            .....:||::.|...:.|||.|..|.|.::...  || :|.:..|||||....||.:.::.::: 
  Fly   108 YNLNNNLAVITLSSELTYTDRITAIPLVASGEA--LPAEGSEVIVAGWGRTSDGTNSYKIRQIS- 169

  Fly   430 LNIVSEANCALELPHVLVQPSSLCAKKTGAGPCASDGGGPLMLREQDVWVLRGVISG----GVIN 490
            |.:..||.| |:......:.|...|.:...|.|..||||             |.|.|    |:.|
  Fly   170 LKVAPEATC-LDAYSDHDEQSFCLAHELKEGTCHGDGGG-------------GAIYGNTLIGLTN 220

  Fly   491 EKENTCELSKPSVFTDVAKHIEWVRQKM 518
            .....|....|.||..::.:.:|:::::
  Fly   221 FVVGACGSRYPDVFVRLSSYADWIQEQI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 61/220 (28%)
Tryp_SPc 277..514 CDD:214473 60/217 (28%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 61/220 (28%)
Tryp_SPc 42..244 CDD:214473 60/217 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.