DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG31220

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:296 Identity:93/296 - (31%)
Similarity:128/296 - (43%) Gaps:61/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 SNGIP----CGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAF--------ICGGTLIS 310
            :|.:|    ||:.:  ||..:..|......:.|||..:..|..|   ||        .|||:||:
  Fly    86 ANTLPSYPDCGKPQ--TTNRVIGGTEPNLNEYPWLAMLLYRNRS---AFNPDRELVPSCGGSLIN 145

  Fly   311 TSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRG-------------VSQLIIHENF 362
            |..||:||||.    .|.......|.||.:|.:.:.|...||             |..:..|.::
  Fly   146 TRYVLTAAHCV----TDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDY 206

  Fly   363 QFKQFT-EADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGL---KSYVAGWGPDETGTGNT- 422
            ....:| ..|:|||||.||||||....|||:      :|.|:.|   |.||||||  :||..:| 
  Fly   207 DPANYTFRNDIALVRLKEPVRYTMAYYPICV------LDYPRSLMKFKMYVAGWG--KTGMFDTG 263

  Fly   423 -EVSKVTDLNIVSEANCALELPHVLVQPS-SLCA-KKTGAGPCASDGGGPLM----LREQDVWVL 480
             :|.|...:.:.....|:.:..|....|. .:|| .....|.|..|.|.|||    ...:.:..|
  Fly   264 SKVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFL 328

  Fly   481 RGVISGGVINEKENTC-ELSKPSVFTDVAKHIEWVR 515
            .|:.|.|      ..| .:..|||||..||..:|:|
  Fly   329 AGITSYG------GPCGTIGWPSVFTRTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 87/273 (32%)
Tryp_SPc 277..514 CDD:214473 85/270 (31%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 85/274 (31%)
Tryp_SPc 104..360 CDD:238113 87/276 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.