DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG8952

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:268 Identity:68/268 - (25%)
Similarity:121/268 - (45%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 ASTTPL-----IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRD 327
            |:::|:     |..|...:.||.||.|.:  :|:: ....:|||::||.:.||:||||...    
  Fly    27 ANSSPIKIDNRIVSGSDAKLGQFPWQVIL--KRDA-WDDLLCGGSIISDTWVLTAAHCTNG---- 84

  Fly   328 LPASRLAVSLG------RNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDY 386
              .|.:.:..|      .|.|.:.|       :.:|||.::..|  ...|::|::|.||:.::..
  Fly    85 --LSSIFLMFGTVDLFNANALNMTS-------NNIIIHPDYNDK--LNNDVSLIQLPEPLTFSAN 138

  Fly   387 IVPICL-WSTSNRMDLPQGLKSYVAGWG-PDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQP 449
            |..|.| ....:.:|. .|..:.:||:| .::.....:|......:.|:..|:|.......:|..
  Fly   139 IQAIQLVGQYGDSIDY-VGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVD 202

  Fly   450 SSLCAK---KTGAGPCASDGGGPLMLREQDV--WVLRGVISGGVINEKENTCELSKPSVFTDVAK 509
            |::|||   .:....|..|.||||:|..:.:  |...|:.|    ...|:.|....||.:..|:.
  Fly   203 STMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINS----FVAEDQCTYRLPSGYARVSS 263

  Fly   510 HIEWVRQK 517
            .:.::..|
  Fly   264 FLGFIADK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 64/252 (25%)
Tryp_SPc 277..514 CDD:214473 64/249 (26%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 65/253 (26%)
Tryp_SPc 38..271 CDD:238113 65/255 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.