DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG31269

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:273 Identity:67/273 - (24%)
Similarity:105/273 - (38%) Gaps:79/273 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHC-----------------F 321
            |..|::.:.|..|:.:::    :....|..|||.:|:.:.||:||||                 :
  Fly    38 IIGGQAAEDGFAPYQISL----QGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKY 98

  Fly   322 RAPGRDLPASRLAVSLGRNTL-AIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTD 385
            ..||            ||..| |||            ||.|:...:. ..|:||:.|.||:.:.:
  Fly    99 NQPG------------GRYFLKAIH------------IHCNYDNPEM-HNDIALLELVEPIAWDE 138

  Fly   386 YIVPICLWSTSNRMDLPQGLKSYVAGWGPDET-GTGNTEVSKVTDLNIVSEANC-AL-------E 441
            ...||.|    ..:.:..|.:..:.|||.... ||...:: :|..|..|....| ||       :
  Fly   139 RTQPIPL----PLVPMQPGDEVILTGWGSTVLWGTSPIDL-QVLYLQYVPHRECKALLSNDEDCD 198

  Fly   442 LPHVLVQPSSLCA-KKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFT 505
            :.|:       |. .:.|.|.|..|.||||:..    ..|.|:::.|.      .|....|.|..
  Fly   199 VGHI-------CTFSRLGEGACHGDSGGPLVSN----GYLVGLVNWGW------PCATGVPDVHA 246

  Fly   506 DVAKHIEWVRQKM 518
            .|..:.:|:|..|
  Fly   247 SVYFYRDWIRNVM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 65/267 (24%)
Tryp_SPc 277..514 CDD:214473 63/264 (24%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 64/267 (24%)
Tryp_SPc 38..258 CDD:238113 66/270 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.