DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Ovch2

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_003749007.2 Gene:Ovch2 / 308919 RGDID:1564636 Length:579 Species:Rattus norvegicus


Alignment Length:301 Identity:77/301 - (25%)
Similarity:133/301 - (44%) Gaps:48/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 NAPQQAVRSPVDLVPQQNPSSNGIPCGRERASTTP--------LIFQGKSLQRGQLPWLVAIFER 294
            :|...::|:|              .||:......|        .|..|..:::|..||.|::.::
  Rat    22 SATLSSIRAP--------------DCGKSLVKPWPQNYFSLFSRIVGGSQVEKGSYPWQVSLKQK 72

  Fly   295 RESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGE-FRGVSQLII 358
            ::     .|||||:||:..|::||||.  ..|:: |..|.|:.|.:.|:....|| ...:..:||
  Rat    73 QK-----HICGGTIISSQWVITAAHCM--ANRNI-ALTLNVTAGEHDLSQAEPGEQTLAIETIII 129

  Fly   359 HENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTE 423
            |..|..|:....|:||:::....::..::.|:||.....:.:  .|.....||||....|....:
  Rat   130 HPQFSTKKPMNYDIALLKMVGTFQFGQFVRPVCLPEPGEQFN--AGYICTTAGWGRLSEGGSLPQ 192

  Fly   424 VSKVTDLNIVSEANC---ALELPHVLVQPSSLCAKKTGAG--PCASDGGGPLMLR-EQDVWVLRG 482
            |.:..:|.|::...|   .|.|.:.:...:.||......|  .|..|.||.||.: .:..|.|.|
  Rat   193 VLQQVNLPILTHEECEAVMLTLRNPITGKTFLCTGSPDGGRDACQGDSGGSLMCQNRKGAWTLAG 257

  Fly   483 VISGGV-------INEKENTCELSKPSVFTDVAKHIEWVRQ 516
            |.|.|:       .|.::.  |...|.:|||:.:.:.|:.:
  Rat   258 VTSWGLGCGRSWRNNARKK--EQGSPGIFTDLRRVLPWIHE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 70/254 (28%)
Tryp_SPc 277..514 CDD:214473 69/250 (28%)
Ovch2XP_003749007.2 Tryp_SPc 52..297 CDD:238113 71/257 (28%)
CUB 317..420 CDD:238001
CUB 431..541 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.