DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG18420

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:264 Identity:89/264 - (33%)
Similarity:125/264 - (47%) Gaps:38/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CG-RERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGR 326
            || |......|.|..||...|...||:.  |....||  .|||||||||...||:|||||     
  Fly    31 CGTRSPLKLGPRIVNGKVAVRNSSPWMA--FLHTSSN--QFICGGTLISRRLVLTAAHCF----- 86

  Fly   327 DLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQF---TEA-DLALVRLDEPVRYTDYI 387
             :|.:.:.|.||.....:..   :|...|  ::..||.:.:   |.| |:||:||...|.|...|
  Fly    87 -IPNTTIVVRLGEYNRKLKG---YREEHQ--VNRTFQHRFYDPNTHANDIALLRLVSNVVYKANI 145

  Fly   388 VPIC-LWSTS--NRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQP 449
            .||| :|..|  :.:|..:.|..  .|||..|:...::|: :..|::......||..    .|..
  Fly   146 RPICIMWDASWKHHIDSIKVLTG--TGWGRTESMHDSSEL-RTLDISRQPSKMCAFG----SVLS 203

  Fly   450 SSLCAKKTGAGPCASDGGGPL--MLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIE 512
            :..||....:..|..|.|||:  |:|.::.:  |.|..|..|..|.  |:  :|||||||..|||
  Fly   204 NQFCAGNWNSNLCIGDTGGPVGAMVRYRNAF--RFVQVGIAITNKR--CQ--RPSVFTDVMSHIE 262

  Fly   513 WVRQ 516
            ::|:
  Fly   263 FIRR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 84/249 (34%)
Tryp_SPc 277..514 CDD:214473 83/245 (34%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 84/249 (34%)
Tryp_SPc 43..267 CDD:238113 85/252 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.