DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG30286

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:274 Identity:75/274 - (27%)
Similarity:116/274 - (42%) Gaps:53/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CGRERASTTPLIFQGKSLQR--GQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPG 325
            ||    ..:|...|.:..|.  .:.||:..:.:..|     .:|||||::...:|:||||.|.. 
  Fly    26 CG----YMSPEALQNEEHQAHISESPWMAYLHKSGE-----LVCGGTLVNHRFILTAAHCIRED- 80

  Fly   326 RDLPASRLAVSLGR-NTLAIHSDGEFRGVSQLIIHENFQFK-QFTEA---------DLALVRLDE 379
                 ..|.|.||. |:|   :..:..|...|...|:|:.. .|...         |:.|:||.:
  Fly    81 -----ENLTVRLGEFNSL---TSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAK 137

  Fly   380 PVRYTDYIVPICLWSTSNRMDLPQGLKSYVA-GWG--PDETGTGNTEVSKVTDLN--IVSEANCA 439
            .|.|..:|.||||.:.:......:.|...|| |||  |.|......:..:||.:|  :.|:..  
  Fly   138 SVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTY-- 200

  Fly   440 LELPHVLVQPSSLCAKKTGAGPCASDGGGP----LMLREQDVWVLRGVISGGVINEKENTCELSK 500
                .|..:...:|........|:.|.|||    :.|..:.::|..|::|.|       ..|...
  Fly   201 ----WVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYG-------NAECLS 254

  Fly   501 PSVFTDVAKHIEWV 514
            |||||:|.:||:|:
  Fly   255 PSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 71/260 (27%)
Tryp_SPc 277..514 CDD:214473 70/258 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 71/257 (28%)
Tryp_SPc 39..268 CDD:214473 70/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.