DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG30187

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:240 Identity:71/240 - (29%)
Similarity:115/240 - (47%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 WLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFR 351
            |:.|:..|..     ||||||||....||:||||.  ..:|:.    :||||....:..:|.  :
  Fly    49 WMAAVHNRTH-----FICGGTLIHKRFVLTAAHCI--VDQDVQ----SVSLGAYNKSDPADR--K 100

  Fly   352 GVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICL---WSTSNRMDLPQGLKSYVAGWG 413
            .|...::|.:|..:...|.|:.|::|...|.:...|.|||:   .|.:|.|...:..|::  |||
  Fly   101 DVITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAF--GWG 163

  Fly   414 PDETGTGN--TEVSKVTDLNIVSEANCALELPHVLVQPS--SLCAKKTGAGPCASDGGGPLMLRE 474
               |..||  :::.:...||.:....|.:||.   |.||  .:||.......|..|.||||   .
  Fly   164 ---TLRGNKTSDILQTIILNHLDREECYMELS---VYPSEKQICAGVPSGDTCGGDSGGPL---T 219

  Fly   475 QDVWVLRGV----ISGGVINEKENTCELSKPSVFTDVAKHIEWVR 515
            .||:: :|:    :..|:|:..:.:|:  ...|:||:....:|::
  Fly   220 NDVFI-QGIGNREVQFGIISVGKTSCD--GQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 71/240 (30%)
Tryp_SPc 277..514 CDD:214473 70/237 (30%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 70/237 (30%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.