DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG30091

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:272 Identity:69/272 - (25%)
Similarity:115/272 - (42%) Gaps:39/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 GIPCGRERASTTPLIFQGKSLQRGQL--PWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFR 322
            |:|     ....|.|..|  :..|:|  ||:..|....|     |||||::|:...||:||||..
  Fly    28 GVP-----MQLIPKIVGG--VDAGELKNPWMALIKTNDE-----FICGGSVITNKFVLTAAHCMC 80

  Fly   323 APGRDL-PASRLAVSLGRNTLAIHSD----GEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVR 382
            .....: ..::|.|:||...|....:    .|...|.::.||::|..:.:.. |:||:||.:.:.
  Fly    81 TDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRN-DIALLRLQKSIV 144

  Fly   383 YTDYIVPICLWSTSNRMDLPQGLKSYVA-GWGPDETGTGNTEVS---KVTDLNIVSEANCALELP 443
            |...|.|:|:............::.:.| |||.    |||.::|   ::..:..:....|.....
  Fly   145 YKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGV----TGNGKMSNNLQMVKIYRIDRKMCEAAFW 205

  Fly   444 HVLVQPSSLCAKKTGAGPCASDGGGPLMLREQDVWVLR----GVISGGVINEKENTCELSKPSVF 504
            :....|........|...|..|.||||.:......:.|    |::|.|       |.:.....::
  Fly   206 YTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTG-------TEDCRGFGMY 263

  Fly   505 TDVAKHIEWVRQ 516
            |||..||:::.:
  Fly   264 TDVMGHIDFIER 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 65/255 (25%)
Tryp_SPc 277..514 CDD:214473 65/251 (26%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 66/255 (26%)
Tryp_SPc 37..276 CDD:238113 66/258 (26%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm50645
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.