DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG30088

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:287 Identity:81/287 - (28%)
Similarity:131/287 - (45%) Gaps:42/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 VDLVPQQNPSSNG-IP-CG-RERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLI 309
            |.||.|:..::|. || || ...::....|.:||.......|::..::...|.:     ||||:|
  Fly    16 VCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIH-----CGGTII 75

  Fly   310 STSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVS------QLIIHENF-QFKQF 367
            |:..:|:||||.|        ..|.|.||.:.:..:.|.:....|      .:::...: :|.:|
  Fly    76 SSRYILTAAHCMR--------PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRF 132

  Fly   368 TEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNI 432
            ...|:||::|...:|:..:|.||||  ..|....|...:....|||..|| ..:..|.:.|.|..
  Fly   133 LANDIALLKLSRNIRFNVHIQPICL--ILNPAAAPNVHEFQAFGWGQTET-NHSANVLQTTVLTR 194

  Fly   433 VSEANC--ALELPHVLVQPSSLCAKKTGAGPCASDGGGPLM--LREQDVW--VLRGVISGGVINE 491
            ....:|  .|.:|..:.|   ||....|:..|:.|.||||:  :....||  :..|::|.|    
  Fly   195 YDNRHCRSVLSMPITINQ---LCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFG---- 252

  Fly   492 KENTCELSKPSVFTDVAKHIEWVRQKM 518
             ::.|:  .|.|:|.|..:|.|:|..|
  Fly   253 -DDKCQ--SPGVYTYVPNYIRWIRYVM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 70/252 (28%)
Tryp_SPc 277..514 CDD:214473 68/249 (27%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 69/253 (27%)
Tryp_SPc 45..273 CDD:238113 70/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.