DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG30083

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:264 Identity:82/264 - (31%)
Similarity:124/264 - (46%) Gaps:45/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRD 327
            ||....|  |.|..|::.:.|..||:..||:..:......:||||||....|||||||.:   ||
  Fly    25 CGYPDIS--PKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIK---RD 84

  Fly   328 LPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEA----DLALVRLDEPVRYTDYIV 388
               ..|||.||.     ||...:..|::.     |:.|.||..    |:.::|:...|::...|.
  Fly    85 ---QILAVRLGE-----HSSSRYFAVTKA-----FRNKYFTTGSYSNDIGILRIQPIVKFNAVIR 136

  Fly   389 PICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLC 453
            |||:.:...::...:..|:  ||||..|..| .::|.|..:||.::.:.| ..:..|.|..|.:|
  Fly   137 PICIITDPTKVPNVKTFKA--AGWGKTENET-FSKVLKTVELNELNASEC-YNMLWVNVTESQIC 197

  Fly   454 AKKTGAGPCASDGGGPLM--------LREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKH 510
            |.......||.|.||||:        ||    :|..|:||.|     .:.|  :.|.|:|.::..
  Fly   198 AGHPDGDTCAGDSGGPLIHPVYMDGSLR----YVQLGIISFG-----SSLC--NSPGVYTRLSSF 251

  Fly   511 IEWV 514
            |:|:
  Fly   252 IDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 77/250 (31%)
Tryp_SPc 277..514 CDD:214473 76/248 (31%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 77/252 (31%)
Tryp_SPc 34..255 CDD:238113 77/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.