DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and F7

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_011535776.2 Gene:F7 / 2155 HGNCID:3544 Length:495 Species:Homo sapiens


Alignment Length:291 Identity:90/291 - (30%)
Similarity:134/291 - (46%) Gaps:67/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PCGR-----ERASTTP--LIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAH 319
            |||:     :|.::.|  .|..||...:|:.||.|.:.    .|| |.:||||||:|..|:||||
Human   223 PCGKIPILEKRNASKPQGRIVGGKVCPKGECPWQVLLL----VNG-AQLCGGTLINTIWVVSAAH 282

  Fly   320 CFR--APGRDLPASRLAVSLGRNTLAIH-SDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPV 381
            ||.  ...|:|    :|| ||.:.|:.| .|.:.|.|:|:||...: ....|..|:||:||.:||
Human   283 CFDKIKNWRNL----IAV-LGEHDLSEHDGDEQSRRVAQVIIPSTY-VPGTTNHDIALLRLHQPV 341

  Fly   382 RYTDYIVPICL-WSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALEL--- 442
            ..||::||:|| ..|.:...|.....|.|:|||                 .::.....||||   
Human   342 VLTDHVVPLCLPERTFSERTLAFVRFSLVSGWG-----------------QLLDRGATALELMVL 389

  Fly   443 --PHVLVQPSSLCAKKTGAGP------------------CASDGGGPLMLREQDVWVLRGVISGG 487
              |.::.|.....::|.|..|                  |..|.|||.....:..|.|.|::|.|
Human   390 NVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRGTWYLTGIVSWG 454

  Fly   488 VINEKENTCELSKPSVFTDVAKHIEWVRQKM 518
                 :....:....|:|.|:::|||:::.|
Human   455 -----QGCATVGHFGVYTRVSQYIEWLQKLM 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 83/266 (31%)
Tryp_SPc 277..514 CDD:214473 82/263 (31%)
F7XP_011535776.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.