DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and try-5

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:304 Identity:65/304 - (21%)
Similarity:115/304 - (37%) Gaps:64/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CGRERASTTPLIFQ--GKSLQRGQL-PWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFR-- 322
            |||:...|:.::..  |.:.....| ||.|.|..:........|||||||:...||:|||||:  
 Worm    29 CGRQSTYTSFMLTDAAGNTGNPTHLAPWAVQIRVKARKGDFEVICGGTLITLKHVLTAAHCFQKH 93

  Fly   323 ------------APGRDLPA----------SRLAVSLGRNTLAIH---------SDGEFRGVSQL 356
                        ..||...:          :|..|::|.....:.         .:|:...:|:.
 Worm    94 FGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMCTRLEQKYGCVNEKQNGKTLKISRF 158

  Fly   357 IIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDE-TGTG 420
            .|.:.::.......|:.::.|:..:...:.....|| .....:::..|......|||.|. .|..
 Worm   159 AIGDFYKTHCEQGNDIVILELESTIDDVEGANYACL-PFLPEVNIQSGANVTSFGWGSDPGKGFD 222

  Fly   421 NTEVSKVTDLNIVSEA------NCALELPHVLVQPSSLC-AKKTGAGPCASDGGGPLMLREQD-- 476
            |.....:..|.:.:|.      |....:|.     .|.| |::.....|:.|.||.|...:.|  
 Worm   223 NAAFPMIQVLTLATETLATCEENWGTSIPF-----DSFCTAEEEDKNVCSGDSGGGLTFHQSDSA 282

  Fly   477 -VWVLRGVISGG-----VINEKENTCELSKPSVFTDVAKHIEWV 514
             .::: .::|.|     :|...|...:::     |||.||.:::
 Worm   283 REFII-AIVSYGSDCVQLIGGSEPRSQIN-----TDVRKHQKFI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 61/288 (21%)
Tryp_SPc 277..514 CDD:214473 61/286 (21%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 53/254 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_124240
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.