DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and try-10

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:239 Identity:64/239 - (26%)
Similarity:97/239 - (40%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 RESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDG--EFRGVSQLI 357
            |..:|...:|||.||:.|.|:::|||..: |.|. |....|:||...|..|.||  |||..:..|
 Worm    95 RFPDGTTNVCGGVLIAPSIVITSAHCVFS-GDDF-AVTAKVTLGDVHLNKHDDGEQEFRSHAMAI 157

  Fly   358 IHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLW-----STSN----------RMDLPQGLKS 407
            ..:.|........|:|::.|  |.|......|:.|.     ||.:          ::.|...: .
 Worm   158 SKKFFNDASEANDDVAVIFL--PQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQLQLETSV-C 219

  Fly   408 YVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAKKTGAG-PCASDGGGPLM 471
            ||||||..|..|     :|.:|  .|.:....|.:..:..:...:....||:. .|..|.|.|:.
 Worm   220 YVAGWGKTENKT-----AKYSD--SVRQMMVNLSVRRIGKRKYLIAKAVTGSSRACMGDSGSPVY 277

  Fly   472 LREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVR 515
            .......:|.|.::        :....||.|. .|.:.||.:.|
 Worm   278 CFVNGKRILVGTVA--------HIGSFSKMSE-QDPSNHISFCR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 64/239 (27%)
Tryp_SPc 277..514 CDD:214473 63/236 (27%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 57/206 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.