DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG43336

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:286 Identity:72/286 - (25%)
Similarity:113/286 - (39%) Gaps:74/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CG-RERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGR 326
            || |..:.:.|.:..|........||:..:    .|....|||||:||:...||:|||||     
  Fly    26 CGIRAHSPSVPRVKNGTVASLTSSPWMAFL----HSTDGRFICGGSLITNRLVLTAAHCF----- 81

  Fly   327 DLPASRLAVSLG---RNTLAIHSDGEFRGVSQLIIHENFQFKQFTEA----DLALVRLDEPVRYT 384
             |..:.|...||   |....:..|.......:.::...|:.:.:...    |:|::||...|:||
  Fly    82 -LDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYRKVQYT 145

  Fly   385 DYIVPICL-----WSTSNRMDLPQGLKSYV--------AGWGPDETGTGNTEVSKVTDLNIVSEA 436
            |.|.|||:     |            :.|:        .|||..|: .|::...:..||      
  Fly   146 DNIRPICIVIDPRW------------RKYIDSLDPLTGTGWGKTES-EGDSAKLRTVDL------ 191

  Fly   437 NCALELPHVLVQPSSL-------CAKKTGAGPCASDGGGPLMLREQDVWVL------RGVISGGV 488
              |.:.|.|..:.::|       ||....:..|..|.|||       |..|      :..:..|:
  Fly   192 --ARKHPEVCRRYATLSLTANQFCAGNERSNLCNGDSGGP-------VGALIPYGKSKRFVQVGI 247

  Fly   489 INEKENTCELSKPSVFTDVAKHIEWV 514
            .:.....|.:  .||||||..:::|:
  Fly   248 ASFTNTQCVM--VSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 68/271 (25%)
Tryp_SPc 277..514 CDD:214473 67/269 (25%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 67/273 (25%)
Tryp_SPc 40..271 CDD:238113 67/270 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.