DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and AgaP_AGAP013487

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_003436426.1 Gene:AgaP_AGAP013487 / 11176153 VectorBaseID:AGAP013487 Length:308 Species:Anopheles gambiae


Alignment Length:290 Identity:91/290 - (31%)
Similarity:142/290 - (48%) Gaps:42/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 QNPSSNGIP----CGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGP-AFICGGTLISTST 313
            ||.||  :|    ||.:....   :..|:|.|..:.|| .|:.|.::.:|. .|.|||:||:...
Mosquito    37 QNTSS--LPESPHCGIQLGDR---VLSGQSTQIDEFPW-TALIEFQKPDGSFGFHCGGSLINDRY 95

  Fly   314 VLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSD--GEF-------RGVSQLIIHENFQFKQFTE 369
            :::||||.::..||....|  |.||...|...:|  .||       ..:.|:::|..:..|..:.
Mosquito    96 IVTAAHCIKSIPRDWKVQR--VRLGEWDLTSANDCQNEFCSDAPIDLDIEQIVVHTGYDTKDKSN 158

  Fly   370 A-DLALVRLDEPVRYTDYIVPICL-WSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNI 432
            | |:||:|...||.|:..:.|||| .|:|.|.....||.||..||....:.|.:.:..|| ::.|
Mosquito   159 ANDIALIRFTRPVNYSQTVRPICLPLSSSLRNRSHDGLISYEVGWRKTNSATASEKKLKV-EVEI 222

  Fly   433 VSEANCA--LELPHVLVQPSSLCA-----KKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVIN 490
            .|...||  .|...:|::.:.:||     |.|    |:.:.|||||.:....|.|.||.|.|   
Mosquito   223 KSLQECAPIYERNGILLKQTHMCAGGVRSKDT----CSGNSGGPLMRQMTGSWYLIGVNSFG--- 280

  Fly   491 EKENTC-ELSKPSVFTDVAKHIEWVRQKMW 519
              ...| ....|.|:|:||::::|::..::
Mosquito   281 --PRKCGTFGVPDVYTNVAEYVDWIKDNIY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 84/259 (32%)
Tryp_SPc 277..514 CDD:214473 83/256 (32%)
AgaP_AGAP013487XP_003436426.1 Tryp_SPc 55..303 CDD:214473 83/263 (32%)
Tryp_SPc 59..306 CDD:238113 84/259 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.