DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and LOC101732176

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:241 Identity:65/241 - (26%)
Similarity:117/241 - (48%) Gaps:20/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 GQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLA-IHS 346
            |..||.:::.:...::  .::|||::|:...:::||||  ..|.....|...|..|..||: .:|
 Frog   286 GDWPWQISLMKLVGTS--LYLCGGSIITPYWIVTAAHC--VYGYTSSPSIFKVFAGSLTLSNYYS 346

  Fly   347 DGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAG 411
            .|..  |.:::||.::. ......|:||::|...:.::..:.|:||.:..  |....|...:::|
 Frog   347 AGYL--VDRVLIHPSYS-PNTQNYDIALLKLKTALVFSTNLRPVCLPNVG--MPWADGQPCWISG 406

  Fly   412 WG-PDETGTGNTEVSKVTDLNIVSEANCALELPH-VLVQPSSLCAKKTGAG--PCASDGGGPLML 472
            || ..|.|:.:|.: |...:.|:|.|.|.|...: .::.|:.:||...|.|  .|..|.||||:.
 Frog   407 WGTTSEAGSISTSL-KAASVPIISSATCNLAPVYGGVISPTMICAGYLGGGTDTCQGDSGGPLVT 470

  Fly   473 REQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVRQKM 518
            :...:|.|.|..|.|.     ......||.|:.::...:||:..:|
 Frog   471 KTNSLWWLVGDTSWGY-----GCARAYKPGVYGNITVFLEWIYSQM 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 64/238 (27%)
Tryp_SPc 277..514 CDD:214473 63/235 (27%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055
Tryp_SPc 277..510 CDD:238113 64/238 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.