DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:281 Identity:69/281 - (24%)
Similarity:114/281 - (40%) Gaps:74/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 EKVIQTPF--------IHNGIEVERGQLPWMAA-LFEHVGRDYNFLCGGTLISARTVISAAHC-- 302
            :|::.||.        |.||.....|::|::.. ||...|   |:.|||::|....|::||||  
  Fly    22 QKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNG---NWWCGGSIIGNTWVLTAAHCTN 83

  Fly   303 ------FRFGS--RNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNP-NVYTDADLALLQ 358
                  ..:|:  ||.|.....|                |....:.|..||. |::.  |::|::
  Fly    84 GASGVTINYGASLRNQPQYTHWV----------------GSGNFVQHHHYNSGNLHN--DISLIR 130

  Fly   359 LSNHVDIGDYIKPICLWNENFLLELPSGHKSY---------VAGWGEDEKGNRNTRLAKMTDTDI 414
             :.|||         .|:....:||||.:..|         .:|||....|:......:..|..|
  Fly   131 -TPHVD---------FWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQI 185

  Fly   415 ITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQD--IWMLRGVVSAGQRMT 477
            ::|.:|....|      :..:.||.:.......|.|||||.|:..|.:  :.:...|.|||    
  Fly   186 MSQSDCSRTWS------LHDNMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAG---- 240

  Fly   478 NRCNLTLPVIYTDVAKHIEWL 498
              |....|.:::.|..:::|:
  Fly   241 --CQSGAPAVFSRVTGYLDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 65/263 (25%)
Tryp_SPc 259..497 CDD:214473 64/260 (25%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 65/264 (25%)
Tryp_SPc 38..262 CDD:238113 66/265 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.