DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:292 Identity:72/292 - (24%)
Similarity:119/292 - (40%) Gaps:73/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAA-LFEHVGRDYNFLCGGTLI 291
            ||.|.|..|..|..:.|           .|.||.....|::|::.. ||...|   |:.|||::|
  Fly    18 PAPAQKLTPTPIKDIQG-----------RITNGYPAYEGKVPYIVGLLFSGNG---NWWCGGSII 68

  Fly   292 SARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATL----------GVARLLIHEQYNP 346
            ....|::||||               :.|.:.:.: :.||::          |...::.|..||.
  Fly    69 GNTWVLTAAHC---------------TNGASGVTI-NYGASIRTQPQYTHWVGSGDIIQHHHYNS 117

  Fly   347 -NVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSY---------VAGWGEDEKGN 401
             |::.  |::|:: :.|||         .|:....:||||.:..|         .:|||....|:
  Fly   118 GNLHN--DISLIR-TPHVD---------FWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGS 170

  Fly   402 RNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWML 466
            ......:..|..||:|.:|....|      :..:.||.:.......|.|||||.|:..:.:  .|
  Fly   171 PLPDWLQSVDVQIISQSDCSRTWS------LHDNMICINTDGGKSTCGGDSGGPLVTHDGN--RL 227

  Fly   467 RGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498
            .||.|.|.  ...|....|.:::.|..:::|:
  Fly   228 VGVTSFGS--AAGCQSGAPAVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 64/261 (25%)
Tryp_SPc 259..497 CDD:214473 63/258 (24%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 65/263 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.