DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG11843

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:275 Identity:79/275 - (28%)
Similarity:125/275 - (45%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 TPFIHNGIEVERGQLPWMAALFEHVGR------DYNFLCGGTLISARTVISAAHCFRFGSRNLPG 312
            ||.|..|...:..:.|.||.|    ||      ..::.|||.|||.|.|::||||.    .:..|
  Fly    65 TPLIVGGHPAQPREFPHMARL----GRRPDPSSRADWFCGGVLISERFVLTAAHCL----ESERG 121

  Fly   313 ERTIVSLGR---NSLDLFSSGATLGVARLLIHEQY-NPNVYTDADLALLQLSNHVDIGDYIKPIC 373
            |..:|.||.   :|||..::.....||..:.|..| :|..|  .|:.|::|:..|....|..|.|
  Fly   122 EVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFY--HDIGLVKLTEAVVFDLYKHPAC 184

  Fly   374 LWNENFLLELPSGHKSYVA-GWGEDEKGNRNTRLAKMTDTDIIT-------QWECRGNLSEENAK 430
            |   .|..|..|  .|::| |||       :|.||......::.       .|.|:..|:.:..:
  Fly   185 L---PFQDERSS--DSFIAVGWG-------STGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEE 237

  Fly   431 FIT----SHTICASNAQASGPCSGDSGGGLMLQEQD---IWMLRGVVSAGQRMTNRCNLT-LPVI 487
            |..    ::.:|..:..|...|:|||||.|::..::   ::::.|:.|||.    .|... :|.|
  Fly   238 FPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGL----SCGSPGIPGI 298

  Fly   488 YTDVAKHIEWLLSSM 502
            ||.|..::.|:..::
  Fly   299 YTRVYPYLGWIARTL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 76/266 (29%)
Tryp_SPc 259..497 CDD:214473 75/263 (29%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 77/269 (29%)
Tryp_SPc 68..309 CDD:214473 76/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.