DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG11841

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:271 Identity:74/271 - (27%)
Similarity:116/271 - (42%) Gaps:57/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 PFIHNGIEVERGQLPWMAAL-FEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVS 318
            |.|.:|...|..:.|:.|.| ......:..:.|||||||.|.|::||||| |...   ||..:|.
  Fly    70 PLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCF-FSEH---GEVNVVR 130

  Fly   319 LGRNSLDLFSSGA---TLGVARLLIHEQY-NPNVYTDADLALLQLSNHVDIGDYIKPICLWNENF 379
            ||....|..:..|   ..||..|..|..: ||.:|.  |:.::||...|....|..|.|      
  Fly   131 LGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYN--DIGIVQLDREVKFNRYKHPAC------ 187

  Fly   380 LLELPSG--HKSYVA-GWGEDEKGNRNT-RLAKM--------------TDTDIITQWECRGNLSE 426
             |....|  |:|::| |||:.:...:.: :|.|:              .:.::...:|.:..|  
  Fly   188 -LPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQL-- 249

  Fly   427 ENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDI---WMLRGVVSAGQRMTNRCNL-TLPVI 487
                       |..:......|:|||||.::...:|:   :.:.|:.|||  :|  |:. .:|..
  Fly   250 -----------CIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAG--IT--CSTPDIPSA 299

  Fly   488 YTDVAKHIEWL 498
            ||.|...:.|:
  Fly   300 YTRVHYFLNWI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 72/267 (27%)
Tryp_SPc 259..497 CDD:214473 71/264 (27%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 73/269 (27%)
Tryp_SPc 72..310 CDD:214473 72/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.