DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9649 and CG16710

DIOPT Version :9

Sequence 1:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:351 Identity:102/351 - (29%)
Similarity:149/351 - (42%) Gaps:89/351 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 TSARPSVHPSN-TPAQASKFYPQ--------------------TIGQL---SGICGREKVIQTPF 256
            ||..|.:.|.| |||:.:.|..:                    .:|.:   :.|||  .::....
  Fly    43 TSLLPFLKPHNMTPAEKAVFEDRYCGYGPKGQELLDRVLICCPNMGHILPNTQICG--PIMPAYR 105

  Fly   257 IHNGIEVERGQLPWMA-ALFEHVGRD-YN----FLCGGTLISARTVISAAHCFRFGSRNLP---- 311
            |..|.|.:..:||||| .|:.|..|. :|    ..|.|:||:.|.|::||||.|....:|.    
  Fly   106 IFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVRL 170

  Fly   312 GERTIVS--------LGRN---------SLDLFSSGATLGVARLLIHEQ--YNPNVYTDADLALL 357
            ||..|:|        .||.         .:||     ::.....::.|:  ||       |:|||
  Fly   171 GEHNILSNPDCVTHINGREHCAPEHLEIDVDL-----SIKHRHYMVFEERPYN-------DIALL 223

  Fly   358 QLSNHVDIGDYIKPICLWNENFLLELP--SGHKSYVAGWGEDEK-GNRNTRLAKMT---DTDIIT 416
            :|...|.....|||||: ..:::...|  |.||..:||||...| |..|..|....   :.|   
  Fly   224 RLKFPVRYTAQIKPICV-QLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQAYVNGRNAD--- 284

  Fly   417 QWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLML----QEQDIWMLRGVVSAGQRMT 477
              ||  :|||.:........|||.|...:..|.|||||.||.    .:::...|.|:.|.|.   
  Fly   285 --EC--SLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGY--- 342

  Fly   478 NRCNLTLPVIYTDVAKHIEWLLSSMW 503
            ::|... |..||..:|.:||:|.:|:
  Fly   343 SQCGYG-PAAYTKTSKFVEWILWNMY 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 86/279 (31%)
Tryp_SPc 259..497 CDD:214473 84/276 (30%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 9/40 (23%)
Tryp_SPc 105..362 CDD:214473 86/280 (31%)
Tryp_SPc 106..362 CDD:238113 86/279 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.